
E3 ubiquitin-protein ligase SMURF2 is an enzyme that in humans is encoded by the SMURF2 gene. The SMURF2 gene is mapped to chromosome 17q22-q23 based on sequence similarity between the SMURF2 sequence and a genomic contig. SMURF2 is a HECT domain E3 ubiquitin ligase involved in degradation of SMADs, TGF-beta receptor (TGFBR), and other substrates. It also functions in regulation of neuronal and planar cell polarity, induction of senescence, and tumor suppression
Optimal dilution of the SMURF2 antibody should be determined by the researcher.
Amino acids DHNNRTTQFTDPRLSANLHLVLNRQNQLKDQQQQQ of human SMURF2 were used as the immunogen for the SMURF2 antibody.
After reconstitution, the SMURF2 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.