>
产品中心 >
Functional_antibody >
NSJ Bio/SP1 Antibody / Specific Protein 1 (R31910)/100 ug/R31910
SP1 (transcription factor Sp1), also known as Specificity Protein 1, is a human transcription factor involved in gene expression in the early development of an organism. It belongs to the Sp/KLF family of transcription factors. The protein is 785 amino acids long, with a molecular weight of 81 kDA. By fluorescence in situ hybridization, Matera and Ward (1993) mapped the SP1 gene to 12q13. By in situ hybridization, Gaynor et al. (1993) concluded that 12q13.1 is the most probable location of the SP1 gene. Segmentation in Drosophila is based on a cascade of hierarchical gene interactions initiated by maternally deposited morphogens that define the spatially restricted domains of gap gene expression at blastoderm. The formation of 7 head segments depends on the function of several genes. Wimmer et al. (1993) showed that one of these genes is the Drosophila homolog of the human transcription factor SP1.
Optimal dilution of the SP1 antibody should be determined by the researcher.
Amino acids EAICPEGIARLANSGINVMQVADLQSINISGNGF of human SP1 were used as the immunogen for the SP1 antibody.
After reconstitution, the SP1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

