>
产品中心 >
Functional_antibody >
NSJ Bio/TGF beta Receptor II Antibody (R32086)/100 ug/R32086

TGFBR2 (Transforming growth factor, beta receptor II) is a member of the Ser/Thr protein kinase family and the TGFB receptor subfamily. It is a transmembrane protein that has a protein kinase domain, forms a heterodimeric complex with another receptor protein, and binds TGF-beta. This receptor/ligand complex phosphorylates proteins, which then enter the nucleus and regulate the transcription of a subset of genes related to cell proliferation. Mutations in this gene have been associated with Marfan syndrome, Loeys-Deitz aortic aneurysm syndrome, Osler-Weber-Rendu syndrome, and the development of various types of tumors. Alternatively spliced transcript variants encoding different informs have been characterized.
Optimal dilution of the TGF beta Receptor II antibody should be determined by the researcher.
Amino acids TLETVCHDPKLPYHDFILEDAASPKCIMKEKKK of human TGFBR2 were used as the immunogen for the TGF beta Receptor II antibody.
After reconstitution, the TGF beta Receptor II antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.