TSG101, known as Tumor susceptibility gene 101, is mapped to 11p15. The protein encoded by this gene belongs to a group of apparently inactive homologs of ubiquitin-conjugating enzymes. The gene product contains a coiled-coil domain that interacts with stathmin, a cytosolic phosphoprotein implicated in tumorigenesis. And the protein may play a role in cell growth and differentiation and act as a negative growth regulator. In vitro steady-state expression of this tumor susceptibility gene appears to be important for maintenance of genomic stability and cell cycle regulation. Mutations and alternative splicing in this gene occur in high frequency in breast cancer and suggest that defects occur during breast cancer tumorigenesis and/or progression.
Optimal dilution of the TSG101 antibody should be determined by the researcher.
Amino acids KHVRLLSRKQFQLRALMQKARKTAGLSDLY of human TSG101 were used as the immunogen for the TSG101 antibody.
After reconstitution, the TSG101 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

