>
产品中心 >
Functional_antibody >
NSJ Bio/UCP1 Antibody [Discontinued, view alternative antibodies] (R32827)/100 ug/R32827
UCP1 (Uncoupling Protein 1), also called Thermogenin or UCP, is an uncoupling protein found in the mitochondria of brown adipose tissue (BAT). Using in situ hybridization, the human UCP gene is assigned to 4q31. Mitochondrial uncoupling proteins (UCP) are members of the family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. Tissue specificity occurs for the different UCPs and the exact methods of how UCPs transfer H+/OH- are not known. UCPs contain the three homologous protein domains of MACPs. This gene is expressed only in brown adipose tissue, a specialized tissue which functions to produce heat.
Optimal dilution of the UCP1 antibody should be determined by the researcher.
Amino acids 134-165 (TEVVKVRLQAQSHLHGIKPRYTGTYNAYRIIA) were used as the immunogen for the UCP1 antibody.
After reconstitution, the UCP1 antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.

