
This gene is a member of the WNT gene family, which consists of structurally related genes that encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is involved in the development of the anterior-posterior axis in the female reproductive tract, and also plays a critical role in uterine smooth muscle pattering and maintenance of adult uterine function. Mutations in this gene are associated with Fuhrmann and Al-Awadi / Raas � Rothschild / Schinzel phocomelia syndromes.
Optimal dilution of the WNT7A antibody should be determined by the researcher.
Amino acids YVLKDKYNEAVHVEPVRASRNKRPTFLKIKK of human WNT7A were used as the immunogen for the WNT7A antibody.
After reconstitution, the WNT7A antibody can be stored for up to one month at 4oC. For long-term, aliquot and store at -20oC. Avoid repeated freezing and thawing.